Human Galectin-3
Product   Human Galectin-3
Cat#   101-6-05A
Sequence   ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPP GAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAY PATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQR GNDVAFHFNPRFNENNRRVI VCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKV AVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Unit/Weight   0.05 mg
Unit Price   $228.00
Description   Recombinant Human Galectin-3 is a member of a large family of carbohydrate-binding proteins. Also known as Mac-2, L29and CBP35, Human Galectin-3 is expressed by a wide range of cell types including activated T-cells, tumor cells, macrophages, osteoclasts, fibroblasts and epithelial cells. Galectin-3 exhibits proinflammatory activities both in vitro and in vivo. Galectin-3 also chemoattracts monocytes and macrophages. Increased circulating levels of Galectin-3 correlate with several types of cancer, suggesting Galectin-3 is involved in tumor growth and metastasis. Human and Mouse Galectin-3 share 80% homology by amino acid sequence. Human Galectin-3 is a recombinant polypeptide chain consisting of 250 amino acids with a MW of 26 kDa.
Molecular Weight   26000 Da
Purity   Purity > 97% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and quantitation on SDS-PAGE against a known standard.
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.