Human EG-VEGF
Product   Human EG-VEGF
Cat#   101-1-32A
Sequence   AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPF FRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Unit/Weight   0.02 mg
Unit Price   $228.00
Description   Human endocrine gland derived vascular endothelial growth factor (EG-VEGF) is selectively expressed in steroidogenic glands and promotes growth of endocrine gland endothelium. The identification of tissue-selective angiogenic factors raises the possibility that other secreted molecules in this class exist. Consistent with such an expression pattern, the human EG-VEGF gene promoter has a potential binding site for steroidogenic factor SF-1, a pivotal element for steroidogenic-specific transcription. In the human ovary, the expression of EG-VEGF is temporally and spatially complementary to the expression of VEGF-A, both in the follicular and in the luteal phase, suggesting complementary and coordinated roles of these molecules in ovarian angiogenesis. EG-VEGF expression also correlates with vascularity in the polycystic ovary syndrome, a leading cause of infertility. Recombinant Human EG-VEGF produced in E. coli is a non-glycosylated single polypeptide chain containing 86 amino acids with a MW of 9,605 Da.
Molecular Weight   9605 Da
Purity   Purity > 97% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.