Human IL-10
Product   Human IL-10
Cat#   101-13-175A
Sequence   MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQM KDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQ AENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSK AVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Unit/Weight   0.01 mg
Unit Price   $228.00
Description   Interleukin-10 (IL-10) is produced by murine T-cells following their stimulation by lectins. The main source for B-cell-derived IL-10 in mice are Ly-1 B-cells that express CD5 and CD11 . Murine keratinocytes also produce IL10. In humans IL-10 is produced by activated CD8(+) peripheral blood T-cells, by T-helper CD4 (+) T-cell clones (resembling Th0 , Th1 , and Th2 ) after both antigen-specific and polyclonal activation, by B-cell lymphomas, and by monocytes following cell activation by bacterial lipopolysaccharides and mast cells. B-cell lines derived from patients with acquired immunodeficiency syndrome and Burkitt's lymphoma constitutively secrete large quantities of IL-10 into the conditioned medium . The synthesis of IL-10 by monocytes is inhibited by IL-4 and IL-10. Recombinant Human IL-10 produced in E. coli is a single non-glycosylated polypeptide chain containing 161 amino acids with a MW of 16.6 kDa.
Molecular Weight   16600 Da
Purity   Purity Approximately 90% as determined by reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.