|
Product
|
Human IL-35
|
|
Cat#
|
101-13-152A
|
|
Sequence
|
EBI3:RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
|
|
Unit/Weight
|
0.01 mg
|
|
Unit Price
|
$348.00
|
|
Description
|
Interleukin 35 (IL-35) is a member of IL-12 cytokine family and is produced by regulatory T-cells (Tregs). This heterodimeric cytokine is comprised of one p35 subunit (also a subunit of IL-12) and one EBI3 subunit (also a subunit of IL-27). IL-35 signals through IL-12Rbeta2 and gp130 heterodimers and homodimers to induce a suppression of inflammatory responses. Human IL-35 is produced in HEK 293. Recombinant human IL-35 is a single chain product, containing 442 amino acids, with a predicted molecular weight of 49 kDa (observed molecular weight of approximately 75-95 KDa reduced and approximately 65-75 kDa unreduced). From N terminus to C terminus, the molecule is comprised of a poly His tag, the EBI3 subunit, a G rich linker and the p35 subunit.
|
|
Molecular Weight
|
49000 Da
|
|
Purity
|
Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
|
|
Storage
|
Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
|