Human MCSF
Product   Human MCSF
Cat#   101-13-132A
Sequence   MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQE QLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSL RLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLD KDWNIFSKNCNNSFAECSSQGHERQSEGS
Unit/Weight   0.01 mg
Unit Price   $228.00
Description   Macrophage colony stimulating factor (M-CSF) is one of the glycoproteins called colony-stimulating factors (CSFs). Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood: the granulocytes and the monocytes-macrophages. M-CSF is synthesized by mesenchymal cells. This cytokine stimulates the survival, proliferation, and differentiation of hematopoietic cells of the monocyte-macrophage series. Some clinical investigations have shown autologous production of M-CSF various human cell lines in vitro and by tumors in vivo. Recombinant Human M-CSF produced in E. coli is a disulfide linked homodimer, non-glycosylated, polypeptide chain containing 2 x 159 amino acids with a MW of 36.8 kDa.
Molecular Weight   36800 Da
Purity   Purity > 97% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.