Human MIF
Product   Human MIF
Cat#   101-13-131A
Sequence   MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAV HVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLL CGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Unit/Weight   0.025 mg
Unit Price   $228.00
Description   MIF (migration inhibitory factor) is a pro-inflammatory cytokine involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as a mediator in regulating the functions of macrophages in host defense, and data has shown that MIF counteracts the anti-inflammatory activity of glucocorticoids. This cytokine has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro, but the physiological substrate is unknown. Human MIF acts on fibroblasts by inducing IL-1, IL-8 and MMP expression, and also stimulates NO production and TNF-alpha release following IFN-gamma activation on macrophages. Recombinant Human MIF forms a trimer in solution due to the interaction of the beta strands of the MIF proteins. Human MIF is a non-glycosylated polypeptide consisting of 115 amino acids with a MW of 12.5 kDa.
Molecular Weight   12500 Da
Purity   Purity Approximately 97% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and quantitation on SDS-PAGE against a known standard.