|
Product
|
Human MIP-4
|
|
Cat#
|
101-13-126A
|
|
Sequence
|
AQVGTNKELCCLVYTSWQIPQKFLVDYSETSPQCPKPGVILLTKRGRQICADPNKKW VQKYISDLKLNA
|
|
Unit/Weight
|
0.01 mg
|
|
Unit Price
|
$228.00
|
|
Description
|
Macrophage inflammatory protein 4 (MIP-4 or C-C motif chemokine 18) is a cytokine that attracts lymphocytes but not monocytes or granulocytes. This cytokine is involved in B-cell migration into B-cell follicles in lymph nodes and attracts na飗e T-lymphocytes toward dendritic cells. MIP-4 activates mactrophages in lymph nodes, has chemotactic activity for na飗e T-cells, CD4+ and CD8+ T-cells, and therefore plays roles in both humoral and cell-mediated immunity responses. Recombinant Human Macrophage Inflammatory Protein-4 produced in E. coli is a single non-glycosylated polypeptide chain containing 69 amino acids with a MW of 7,813 Da. MIP-4 is a cytokine that attracts lymphocytes but not monocytes or granulocytes. This cytokine is involved in B-cell migration into B-cell follicles in lymph nodes and attracts na飗e T-lymphocytes toward dendritic cells. MIP-4 activates mactrophages in lymph nodes, has chemotactic activity for na飗e T-cells, CD4+ and CD8+ T-cells, and therefore plays roles in both humoral and cell-mediated immunity responses. , Recombinant Human Macrophage Inflammatory Protein-4 produced in E. coli is a single non-glycosylated polypeptide chain containing 69 amino acids with a MW of 7,813 Da.
|
|
Molecular Weight
|
7813 Da
|
|
Purity
|
Purity > 98% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
|
|
Storage
|
Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
|
|