|
Product
|
Human Rantes
|
|
Cat#
|
101-13-110A
|
|
Sequence
|
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVT RKNRQVCANPEKKWVREYINSLEMS
|
|
Unit/Weight
|
0.02 mg
|
|
Unit Price
|
$228.00
|
|
Description
|
RANTES is a chemoattractant for blood monocytes, memory T-helper cells and eosinophils. This cytokine causes the release of histamine from basophils and activates eosinophils. RANTES binds to CCR1, CCR3, CCR4 and CCR5, and is one of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form, RANTES (3-68), acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1 infection. The second processed form, RANTES (4-168), exhibits reduced chemotactic and HIV-suppressive activity compared to RANTES(1-68 and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. Recombinant Human Rantes produced in E. coli is a single non-glycosylated polypeptide chain containing 68 amino acids with a MW of 7,809.2 Da.
|
|
Molecular Weight
|
7809 Da
|
|
Purity
|
Purity > 98% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
|
|
Storage
|
Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
|
|