Product
|
Human SDF-1-alpha
|
Cat#
|
101-13-105A
|
Sequence
|
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLK NNNRQVCIDPKLKWIQEYLEKALNK
|
Unit/Weight
|
0.01 mg
|
Unit Price
|
$228.00
|
Description
|
Stromal-Derived Factor (SDF-1) is a chemoattractant active on T-lymphocytes and monocytes, but not neutrophils. This cytokine activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-alpha (3-67) and SDF-1-beta (3-72) show a reduced chemotactic activity. Binding to cell surface proteoglycans inhibits formation of SDF-1-alpha (3-67), preserving the activity of SDF-1 on local sites. SDF-2 acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the Lyn kinase SDF-1 stimulates migration of monocytes through its receptor, CXCR4, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. Recombinant Human SDF-1 produced in E. coli is a non-glycosylated polypeptide chain containing 68 amino acids with a MW of 8,008 Da.
|
Molecular Weight
|
8008 Da
|
Purity
|
Purity > 98% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
|
Storage
|
Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
|
|