Human TNF-beta
Product   Human TNF-beta
Cat#   101-13-95A
Sequence   His-Tag sequence not included: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQ NSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKA TSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQ LTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Unit/Weight   0.01 mg
Unit Price   $228.00
Description   Tumor necrosis factor beta (TNF beta) is a potent multifunctional cytokine produced mainly by activated T and B lymphocytes. The protein has been shown to have a specific potent cytotoxic activity on tumor cells and a variety of other target cells. TNF beta is also a mediator of inflammation and immune functions. Recombinant TNF beta comprises a 171 amino acid fragment (35-205) corresponding to the mature TNF beta chain protein and is expressed in E. coli with an amino-terminal hexahistidine tag.Tumor necrosis factor beta (TNF beta) is a potent multifunctional cytokine produced mainly by activated T and B lymphocytes. The protein has been shown to have a specific potent cytotoxic activity on tumor cells and a variety of other target cells. TNF beta is also a mediator of inflammation and immune functions. Recombinant TNF beta comprises a 171 amino acid fragment (35-205) corresponding to the mature TNF beta chain protein and is expressed in E. coli with an amino-terminal hexahistidine tag.
Molecular Weight   23.30 kDa
Purity   Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment.