|
Product
|
Human VEGF-121
|
|
Cat#
|
101-13-92A
|
|
Sequence
|
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPD EIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRI KPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
|
|
Unit/Weight
|
0.01 mg
|
|
Unit Price
|
$228.00
|
|
Description
|
Vascular endothelial growth factor-A (VEGF-A) was originally isolated from tumor cells and referred to as Tumor Angiogenesis Factor or Vascular Permeability Factor. Although expressed at high levels in certain tumor-derived cells it is produced by a wide variety of cell types. In addition to stimulating vascular growth and vascular permeability, it may play a role in stimulating vasolidation via nitric oxide-dependent pathways. Alternative splicing of VEGF-A mRNA results in several isoforms of the protein. Rat and bovine VEGF are one amino acid shorter than the human factor, and the bovine and human sequences show a homology of 95 percent. In contrast to other factors mitogenic for endothelial cells such as FGF-1 , FGF-2 and PDGF, VEGF is synthesized as a precursor containing a typical hydrophobic secretory signal sequence of 26 amino acids. Glycosylation is not required for efficient secretion of VEGF. Recombinant Human VEGF-121 produced in E. coli is a double, non-glycosylated, polypeptide chain containing 121 amino acids with a MW of 28,423 Da.
|
|
Molecular Weight
|
28423 Da
|
|
Purity
|
Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
|
|
Storage
|
Store at -20°C. Product is guaranteed one year from the date of shipment.
|
|