Mouse CD40L
Product   Mouse CD40L
Cat#   101-13-86A
Sequence   MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLT VKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTH SSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVG FSSFGLLKL
Unit/Weight   0.025 mg
Unit Price   $228.00
Description   CD40L or CD154 is a membrane glycoprotein and differentiation antigen expressed on the surface of T-cells. The CD40 ligand binds to TNFRSF5 and stimulates B-cell proliferation and secretion of all immunoglobulin isotypes in the presence of cytokines. CD40 ligand has been shown to induce cytokine production and tumoricidal activity in peripheral blood monocytes. It also co-stimulates proliferation of activated T-cells and this is accompanied by the production of IFN-gamma, TNF-alpha, and IL2. The soluble form derives from the membrane form by proteolytic processing. Recombinant Mouse sCD40 ligand produced in E. coli is a non-glycosylated polypeptide chain containing 149 amino acids with a MW of 16,409 Da.
Molecular Weight   16409 Da
Purity   Purity > 98% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by RP-HPLC calibrated against a known standard and UV spectroscopy at 280 nm. Quantitation on SDS-PAGE against a known standard.
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.