Mouse GM-CSF
Product   Mouse GM-CSF
Cat#   101-13-77A
Sequence   MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVS NEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQT YCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Unit/Weight   0.01 mg
Unit Price   $228.00
Description   Granulocyte-macrophage colony-stimulating factor (GM-CSF) is produced in response to a number of inflammatory mediators by mesenchymal cells present in the hemopoietic environment and at peripheral sites of inflammation. GM-CSF is able to stimulate the production of neutrophilic granulocytes, macrophages, and mixed granulocyte-macrophage colonies from bone marrow cells and can stimulate the formation of eosinophil colonies from fetal liver progenitor cells. GM-CSF can also stimulate some functional activities in mature granulocytes and macrophages. GM-CSF receptors shows significant homologies with other receptors for hematopoietic growth factors , including IL2-beta, IL-3, IL-6, IL-7, EPO and the Prolactin receptors. Recombinant mouse GM-CSF produced in E. coli is a single non-glycosylated polypeptide chain containing 125 amino acids with a MW of 14,285.35 Da.
Molecular Weight   14285 Da
Purity   Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Storage   Store at -20C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.