Mouse IL-15
Product   Mouse IL-15
Cat#   101-13-69A
Sequence   MNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTA MNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKN VAESGCKECE ELEEKTFTEFLQSFIRIVQMFINTS
Unit/Weight   0.01 mg
Unit Price   $228.00
Description   Interleukin-15 (IL-15) is a pleiotropic pro-inflammatory cytokine that is expressed in several inflammatory disorders, including rheumatoid arthritis, psoriasis and pulmonary inflammatory diseases. IL-15 promotes activation of T cells, neutrophils and macrophages, and is critical to dendritic cell function in several model systems. Recent emerging data suggest that IL-15 may serve as a useful therapeutic target across a range of disease states. Advances in the past year highlight the beneficial effect of IL-15 neutralization in models of psoriasis and diabetes. Further evidence for IL-15 expression and effector function has emerged across a range of rheumatic disorders, including juvenile inflammatory arthritis, rheumatoid arthritis and Kawasaki disease. Interleukin-15 (IL-15) is a gamma-common cytokine, which plays an important role in the development,survival and proliferation of NK, NK T and CD8+ T cells. Recombinant Mouse IL-15 produced in E. coli is a single non-glycosylated polypeptide chain containing 115 amino acids with a MW of 13,321 Da.
Molecular Weight   13321 Da
Purity   Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.