Mouse IL-17AF
Product   Mouse IL-17AF
Cat#   101-13-66A
Sequence   IL-17A:MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVN AEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA IL-17F:MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Unit/Weight   0.025 mg
Unit Price   $228.00
Description   Interleukin-17AF (IL-17AF) is a member of the IL-17 family of proteins produced by a subset of T cells, called Th17, following stimulation with IL-23. Since IL-17AF is thought to signal through the IL-17R receptor, its biological function is similar to that of IL-17A in that it induces the production of a variety of chemokines, in addition to airway neutrophilia. In regard to these functions, IL-17AF has less activity than the IL-17A homodimer but, greater activity than the IL-17F homodimer. Human and rat IL-17AF both show activity on mouse cells. Mouse IL-17AF is produced in E.coli. Recombinant mouse IL-17AF is a non-glycosylated, disulfide-linked heterodimer. It is containing one IL-17A subunit and one IL-17F subunit, with a total of 271 amino acids and an molecular weight of 30.7 kDa.
Molecular Weight   30700 Da
Purity   Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Storage   Store at -20C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.