Mouse IL-17E
Product   Mouse IL-17E
Cat#   101-13-65A
Sequence   MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Unit/Weight   0.025 mg
Unit Price   $228.00
Description   Interleukin-17E (IL-17E), also commonly called IL-25, is a pro-inflammatory cytokine member of a six-species family of proteins (IL-17A-17F). IL-17F stimulates secretion of IL-8 and induces activation of NF-kB by binding to the receptor IL-17RB. Mouse IL-17E is produced in E.coli. Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing two 154 amino acid chains, with a total molecular weight of 35.5 kDa.
Molecular Weight   35500 Da
Purity   Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.