Mouse EBI-3
Product   Mouse EBI-3
Cat#   101-13-49A
Sequence   MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVAT QQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFV AERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRG ASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQV ESAPHKP
Unit/Weight   0.01 mg
Unit Price   $228.00
Description   Epstein-Barr Virus Induced Gene-3 (EBI-3 or IL27-beta) is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. This cytokine can regulate T helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and has diverse effects on innate immune cells. It synergizes with IL-12 to trigger interferon-gamma production in na飗e CD4 T-cells, and binds to the cytokine receptor WSX-1/TCCR. It also has antitumor and antiangiogenic activity by inducing the production of antiangiogenic chemokines. Recombinant Mouse EBI is a non-glycosylated polypeptide chain consisting of 207 amino acids with a MW of 22.9 kDa.
Molecular Weight   22900 Da
Purity   Purity > 90% as determined by analytical HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and quantitation on SDS-PAGE against a known standard
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.