Mouse IL-17-A
Product   Mouse IL-17-A
Cat#   101-13-39A
Sequence   MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSR RPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVN AEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVG VGCTCVASIVRQAA
Unit/Weight   0.025 mg
Unit Price   $228.00
Description   Interleukin-17A (IL-17A), also known as CTLA-8, is a proinflammatory cytokine member of a six-species family of proteins (IL-17A-17F). Mouse IL-17A protein is a homodimer consisting of two 134 amino acids peptides. IL-17A is secreted mainly by activated CD4+ and CD8+ T lymphocytes and acts through its receptor, IL-17R, to induce the expression of many mediators of inflammation, most strikingly, those that are involved in the proliferation, maturation and chemotaxis of neutrophils. Elevated levels of IL-17A have been associated with several conditions, including rheumatoid arthritis, airway inflammation, allograft rejection, inflammatory bowel disease, psoriasis, cancer and multiple sclerosis. There is 58% identity between the amino acid sequence of human and mouse IL-17A. Recombinant mouse IL-17A produced in E. coli is a non-
Molecular Weight   30000 Da
Purity   Purity > 98% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and quantitation on SDS-PAGE against a known standard.
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.