|
Product
|
Mouse MIP-3-beta
|
|
Cat#
|
101-13-24A
|
|
Sequence
|
GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLC APPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
|
|
Unit/Weight
|
0.02 mg
|
|
Unit Price
|
$228.00
|
|
Description
|
Macrophage inflammatory protein 3 beta (MIP-3-alpha or C-C motif chemokine 19) is is a cytokine that plays a role in inflammatory and immunological responses as well as normal lymphocyte recirculation and homing. MIP-3-beta also is important in T-cell trafficking in the thymus, and T-cell and B-cell migration to secondary lymphoid organs. MIP-3-beta specifically binds to the chemokine receptor CCR7. Recombinant Mouse MIP-3 alpha has a MW of 7.9 kDa, comprised of 70 amino acids. Recombinant Mouse Macrophage Inflammatory Protein-3-beta (CCL 19) is an important chemoattractant for dendritic cells, antigen-engaged B-cells and effector-memory T-cells, signaling specifically through the CCR7 receptor. This cytokine plays a role in promoting encounters between recirculating T-cells and dendritic cells and in the migration of activated B-cells into the T-zone of secondary lymphoid tissues. Recombinant mouse MIP-3-beta is a polypeptide chain consisting of 83 amino acids with a MW of 9.2 kDa.
|
|
Molecular Weight
|
9200 Da
|
|
Purity
|
Purity > 98% as determined by analytical HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and quantitation on SDS-PAGE against a known standard.
|
|
Storage
|
Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
|