Mouse Rank Ligand
Product   Mouse Rank Ligand
Cat#   101-13-20A
Sequence   PAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGW AKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVV KTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQV SNPSLLDPDQDATYFGAFKVQDID
Unit/Weight   0.01 mg
Unit Price   $228.00
Description   RANK Ligand (RANKL) occurs in 3 forms: cell-bound RANKL, which is expressed by osteoblast lineage cells, soluble RANKL, which is expressed by activated T lymphocytes, and a truncated ectodomain form derived from the cell-bound RANKL, which is enzymatically processed by TACE. All three forms stimulate their specific receptors, TNFRSF11B/OPG and TNFRSF11A/RANK, which are located on osteoclastic and dendritic cells. RANKL is critically involved in osteoclastic function, and in the regulation of specific immunity. Recombinant M-sRANK Ligand is approximately 19.9 kDa and contains 174 amino acids.
Molecular Weight   19900 Da
Purity   Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Storage   Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.